• Featured Product
  • KD/KO Validated

Smac/DIABLO Polyclonal antibody

Smac/DIABLO Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 10434-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

DIABLO, DFNA64, Direct IAP-binding protein with low pI, Diablo IAP-binding mitochondrial protein, cleaved form, Diablo IAP-binding mitochondrial protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue
Positive IP detected inHepG2 cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10434-1-AP targets Smac/DIABLO in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0696

Product name: Recombinant human DIABLO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC011909

Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Predict reactive species
Full Name diablo homolog (Drosophila)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC011909
Gene Symbol DIABLO
Gene ID (NCBI) 56616
RRIDAB_2092647
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NR28
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)

Protocols

Product Specific Protocols
WB protocol for Smac/DIABLO antibody 10434-1-APDownload protocol
IHC protocol for Smac/DIABLO antibody 10434-1-APDownload protocol
IF protocol for Smac/DIABLO antibody 10434-1-APDownload protocol
IP protocol for Smac/DIABLO antibody 10434-1-APDownload protocol
FC protocol for Smac/DIABLO antibody 10434-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Eur J Med Chem

PKM2/PDK1 dual-targeted shikonin derivatives restore the sensitivity of EGFR-mutated NSCLC cells to gefitinib by remodeling glucose metabolism

Authors - Hongyan Lin
mouseWB

J Cell Physiol

Resveratrol ameliorates podocyte damage in diabetic mice via SIRT1/PGC-1α mediated attenuation of mitochondrial oxidative stress.

Authors - Tao Zhang
WB

Ann Transl Med

Botrychium schaffneri Underw. extract acts via DIABLO to induce apoptosis and inhibit proliferation of non-small cell lung carcinoma in vitro and in vivo.

Authors - Yu-Jia Liu
humanWB

Chin Med

Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo.

Authors - Hong-Yan Lin
humanWB

Acta Biochim Biophys Sin (Shanghai)

Cathelicidin PR-39 peptide inhibits hypoxia/reperfusion-induced kidney cell apoptosis by suppression of the endoplasmic reticulum-stress pathway.

Authors - Jing Liu
ratIHC

Mol Med Rep

Mechanisms underlying the protective effect of tannic acid against arsenic trioxide‑induced cardiotoxicity in rats: Potential involvement of mitochondrial apoptosis.

Authors - Yucong Xue

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

SHUBHAM (Verified Customer) (03-14-2019)

good

  • Applications: Western Blot,
  • Cell Tissue Type: AC16
Smac/DIABLO Antibody Western Blot, validation ( dilution) in AC16 (Cat no:10434-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...