Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10434-1-AP targets Smac/DIABLO in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0696 Product name: Recombinant human DIABLO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC011909 Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED Predict reactive species |
| Full Name | diablo homolog (Drosophila) |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC011909 |
| Gene Symbol | DIABLO |
| Gene ID (NCBI) | 56616 |
| RRID | AB_2092647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NR28 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IF protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IHC protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IP protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| WB protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-SMAC/DIABLO (Cat# 10434-1-AP) has 21 citations across journals including EMBO J, J Cell Biol, Sci Adv, JACC Basic Transl Sci, ACS Appl Mater Interfaces, Int J Mol Sci, Toxicology, Mol Med Rep, Chin Med, Eur J Med Chem, Adv Healthc Mater, J Hazard Mater, Ann Transl Med, J Cell Physiol, Genes, Animals, Med Sci Monit, Oncol Lett, Biol Trace Elem Res, and Acta Biochim Biophys Sin. Research fields span mitochondrial apoptosis, oncology, oxidative stress, cardiotoxicity, reproductive toxicity, nephroprotection, and nanomedicine.
| Species | Application | Title |
|---|---|---|
Adv Healthc Mater Transdermal Delivery of Icariin via Microneedle Patches Attenuates Phthalate-Induced Testicular Injury. | ||
J Hazard Mater Silk fibroin microneedles loaded with epigallocatechin gallate mitigate atrazine-induced testicular toxicity | ||
JACC Basic Transl Sci PCSK9 Promotes Hypoxia-Induced EC Pyroptosis by Regulating Smac Mitochondrion-Cytoplasm Translocation in Critical Limb Ischemia | ||
EMBO J Stress-induced OMA1-mediated cleavage of AIFM1 suppresses cell growth by controlling mitochondrial OXPHOS activity. | ||
JACC Basic Transl Sci Bag3 Regulates Mitochondrial Function and the Inflammasome Through Canonical and Noncanonical Pathways in the Heart | ||
ACS Appl Mater Interfaces ROS-Triggered Self-Assembled Nanoparticles Based on a Chemo-Sonodynamic Combinational Therapy Strategy for the Noninvasive Elimination of Hypoxic Tumors |
Reviews
What customers say
All three reviews are positive, with an average rating of 4.7 out of 5. Users consistently report reliable performance in Western blot applications. One reviewer noted it "works as it should be," another confirmed it "performs reliably in Western blot analysis," and a third gave it a 4-star rating with the comment "good" when used on AC16 cells. No negative feedback or issues were reported across the reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ziwei (Verified Customer) (01-04-2026) | works as it should be.
|
Ziwei (Verified Customer) (12-14-2025) | The antibody performs reliably in Western blot analysis.
|
SHUBHAM (Verified Customer) (03-14-2019) | good
 |
