• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Smac/DIABLO Polyclonal antibody

Smac/DIABLO Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10434

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

DIABLO, DFNA64, Diablo homolog, mitochondrial, Diablo IAP-binding mitochondrial protein, Diablo IAP-binding mitochondrial protein, cleaved form

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10434 targets Smac/DIABLO in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0696

Product name: Recombinant human DIABLO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC011909

Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Predict reactive species
Full Name diablo homolog (Drosophila)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC011909
Gene Symbol DIABLO
Gene ID (NCBI) 56616
RRIDAB_3083877
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NR28
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Smac/DIABLO antibody CL488-10434Download protocol
FC protocol for CL Plus 488 Smac/DIABLO antibody CL488-10434Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...