DIAPH2 Polyclonal antibody

• 

  WB analysis of HEK-293T using 31304-1-AP

  WB result of DIAPH2 antibody (31304-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DIAPH2 transfected HEK-293T cells.

• 

  WB analysis using 31304-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31304-1-AP (DIAPH2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

DIAPH2 Polyclonal Antibody for WB, ELISA

Cat No. 31304-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DIA, DIA2, DRF2

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31304-1-AP targets DIAPH2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35280

  Product name: Recombinant human DIAPH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-146 aa of NM_006729.4

  Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT

• Full Name: diaphanous homolog 2 (Drosophila)
• Calculated Molecular Weight: 126kDa
• Observed Molecular Weight: 126-130 kDa
• GenBank Accession Number: NM_006729.4
• Gene Symbol: DIAPH2
• Gene ID (NCBI): 1730
• RRID: AB_3669941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60879
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In vertebrates, three DRF genes (DIAPH1, DIAPH2 and DIAPH3) are the orthologs of the Drosophila melanogaster diaphanous (dia) gene, which has important roles in fertility and hearing in the fly. DIAPH1 and DIAPH3 have been associated with different types of hearing loss (HL). DIAPH2, located on chromosome Xq21.33, until now it has only been linked to premature ovarian failure 2 (POF2A). (PMID: 36689403)