Tested Applications
Positive WB detected in | A2780 cells, HEK-293 cells, HEK-293T cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28816-1-AP targets DIS3L2 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30634 Product name: Recombinant human DIS3L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-201 aa of BC036113 Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG Predict reactive species |
Full Name | DIS3 mitotic control homolog (S. cerevisiae)-like 2 |
Observed Molecular Weight | 65 kDa, 99 kda |
GenBank Accession Number | BC036113 |
Gene Symbol | DIS3L2 |
Gene ID (NCBI) | 129563 |
RRID | AB_2881217 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IYB7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DIS3L2 antibody 28816-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |