DLEU7 Polyclonal antibody

• 

  WB analysis using 27250-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27250-1-AP (DLEU7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DLEU7 Polyclonal Antibody for WB, ELISA

Cat No. 27250-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

LEU7, Leukemia associated protein 7

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27250-1-AP targets DLEU7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24414

  Product name: Recombinant human DLEU7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC104892

  Sequence: MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGGGVGTRSRRTAARVNSPEEEVV

• Full Name: deleted in lymphocytic leukemia, 7
• Calculated Molecular Weight: 221aa,24 kDa; 160aa,17 kDa
• Observed Molecular Weight: 17-24 kDa
• GenBank Accession Number: BC104892
• Gene Symbol: DLEU7
• Gene ID (NCBI): 220107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UYE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLEU7 (Deleted in Lymphocytic Leukemia 7) is a tumor suppressor protein, frequently inactivated in B-cell chronic lymphocytic leukemia (CLL). This 221-amino-acid protein functions as a critical negative regulator of NF-κB signaling by directly inhibiting TACI and BCMA, key transducers of B-cell proliferative signals. Through this mechanism, DLEU7 suppresses cell proliferation and induces apoptosis. DLEU7 represents a potential therapeutic target in CLL and other B-cell malignancies (PMID: 34277865; 35892027).