Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27250-1-AP targets DLEU7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24414 Product name: Recombinant human DLEU7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC104892 Sequence: MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGGGVGTRSRRTAARVNSPEEEVV Predict reactive species |
| Full Name | deleted in lymphocytic leukemia, 7 |
| Calculated Molecular Weight | 221aa,24 kDa; 160aa,17 kDa |
| Observed Molecular Weight | 17-24 kDa |
| GenBank Accession Number | BC104892 |
| Gene Symbol | DLEU7 |
| Gene ID (NCBI) | 220107 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6UYE1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DLEU7 (Deleted in Lymphocytic Leukemia 7) is a tumor suppressor protein, frequently inactivated in B-cell chronic lymphocytic leukemia (CLL). This 221-amino-acid protein functions as a critical negative regulator of NF-κB signaling by directly inhibiting TACI and BCMA, key transducers of B-cell proliferative signals. Through this mechanism, DLEU7 suppresses cell proliferation and induces apoptosis. DLEU7 represents a potential therapeutic target in CLL and other B-cell malignancies (PMID: 34277865; 35892027).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DLEU7 antibody 27250-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

