Product Information
29457-1-PBS targets DLG2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30193 Product name: Recombinant human DLG2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 295-417 aa of NM_001142699 Sequence: HSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEG Predict reactive species |
| Full Name | discs, large homolog 2 (Drosophila) |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | NM_001142699 |
| Gene Symbol | DLG2 |
| Gene ID (NCBI) | 1740 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15700 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Disks large homolog 2 (DLG2) also known as channel-associated protein of synapse-110 (chapsyn-110) or postsynaptic density protein 93 (PSD-93) is a protein encoded by the DLG2 gene. Chapsyn-110/PSD-93 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins (PMID: 8755482 9806853).

