HURP Polyclonal antibody

• 

  WB analysis using 12038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12038-1-AP (HURP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 12038-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 12038-1-AP (HURP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

HURP Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12038-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DAP-5, Discs large homolog 7, Disks large-associated protein 5, Disks large-associated protein DLG7, DLG7

---

Tested Applications

• Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cells, A431 cells, PC-3 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 8 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

12038-1-AP targets HURP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2667

  Product name: Recombinant human HURP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 498-847 aa of BC010658

  Sequence: IKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF

• Full Name: discs, large (Drosophila) homolog-associated protein 5
• Calculated Molecular Weight: 846 aa, 95 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC010658
• Gene Symbol: HURP
• Gene ID (NCBI): 9787
• RRID: AB_10665363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15398
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLGAP5, also named as DAP 5 or DLG7, is a kinetochore protein that stabilizes microtubules in vicinity of chromosomes. DLG7 controls spindle dynamics, promotes interkinetochore tension and efficient kinetochore capture. DGL7 is a part of Ran-dependent complex. Expression of DGL7 is found in cancer and stem cells. DLGAP5 contributes to hepatocellular carcinoma tumorigenesis by promoting cell proliferation (PMID: 24324629).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; HURP facilitates spindle assembly by stabilizing microtubules and working synergistically with TPX2; Authors - Venecia Alexandria Valdez
human	IHC	J Transl Med; Integrative multi-omics analysis unveils stemness-associated molecular subtypes in prostate cancer and pan-cancer: prognostic and therapeutic significance; Authors - Kun Zheng
human	WB,IHC	J Transl Med; DLGAP5 promotes lung adenocarcinoma growth via upregulating PLK1 and serves as a therapeutic target; Authors - Maojian Chen ; KD Validated
pig	IF	Cells; Mitotic Acetylation of Microtubules Promotes Centrosomal PLK1 Recruitment and Is Required to Maintain Bipolar Spindle Homeostasis.; Authors - Sylvia Fenosoa Rasamizafy
human	WB,IHC	Life Sci; Pan-cancer analysis and experiments with cell lines reveal that the slightly elevated expression of DLGAP5 is involved in clear cell renal cell carcinoma progression.; Authors - Yun Feng ; KD Validated
human	WB	Front Endocrinol (Lausanne); Whole Genome Transcriptomic Analysis of Ovary Granulosa Cells Revealed an Anti-Apoptosis Regulatory Gene DLGAP5 in Polycystic Ovary Syndrome.; Authors - Yan Deng