DLL1 Polyclonal antibody, PBS Only

DLL1 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 28544-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28544-1-PBS targets DLL1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29534

Product name: Recombinant human DLL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 568-715 aa of NM_005618

Sequence: CVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKD

Predict reactive species
Full Name delta-like 1 (Drosophila)
Calculated Molecular Weight 78 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_005618
Gene Symbol DLL1
Gene ID (NCBI) 28514
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00548
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The Notch pathway functions during diverse developmental and physiological processes. Notch receptor and its ligands, Delta and Jagged, are transmembrane proteins with large extracellular domains that consist primarily of epidermal growth factor (EGF)-like repeats (PMID: 16921404). Delta-like protein 1 (DLL1, also named as Delta1) is a ligand of NOTCH1, NOTCH2 and NOTCH3 receptors that binds the extracellular domain of Notch receptor in a cis and trans fashion manner (PMID: 11006133). DLL1 play a role in development of the central nervous system, somites and lymphocytes (PMID: 31353024). It is overexpressed in various cancers and is involved in the regulation of cancer progression (PMID: 32440154). DLL1 undergoes proteolytic processing in its extracellular domain by ADAM proteases and gamma-secretase (PMID: 17107962; 12794186).

Loading...
||
New chat Able
正在加载,请稍候...