DMBT1 Polyclonal antibody

• 

  IHC staining of human stomach cancer using 27069-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27069-1-AP (DMBT1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27069-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27069-1-AP (DMBT1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 27069-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27069-1-AP (DMBT1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 27069-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27069-1-AP (DMBT1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of human brain using 27069-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human brain tissue using DMBT1 antibody (27069-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human brain using 27069-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human brain tissue using DMBT1 antibody (27069-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

DMBT1 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 27069-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

muclin, Hensin, Gp-340, GP340, Gp 340

---

Tested Applications

• Positive IHC detected in: human stomach cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27069-1-AP targets DMBT1 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16229

  Product name: Recombinant human DMBT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1313-1662 aa of BC153299

  Sequence: IEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQDLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVSRSKRDVGSYQEKVDVVLGPIQLQTPPRREEEPR

• Full Name: deleted in malignant brain tumors 1
• Calculated Molecular Weight: 2413 aa, 261 kDa
• GenBank Accession Number: BC153299
• Gene Symbol: DMBT1
• Gene ID (NCBI): 1755
• RRID: AB_2880741
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGM3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Deleted in malignant brain tumors 1 (DMBT1), also known as the salivary scavenger and agglutinin (SALSA), salivary agglutinin (SAG) or gp340, is a multifunctional molecule with important functions in innate immunity, inflammation and epithelial homeostasis (PMID: 28668353). DMBT1 has some isoforms with the molecular weight of 193, 260 and 340 kDa.