DNMT1 Recombinant monoclonal antibody

DNMT1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82678-2-RR
Clone No.240302E2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

DNMT, DNA (cytosine-5)-methyltransferase 1, CXXC-type zinc finger protein 9, CXXC9, AIM

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293T cells, PC-12 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82678-2-RR targets DNMT1 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29479

Product name: Recombinant human DNMT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 300-500 aa of BC126227

Sequence: KKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFA

Predict reactive species
Full Name DNA (cytosine-5-)-methyltransferase 1
Calculated Molecular Weight 1632 aa, 185 kDa
Observed Molecular Weight200 kDa
GenBank Accession NumberBC126227
Gene Symbol DNMT1
Gene ID (NCBI) 1786
RRIDAB_3670526
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26358
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation, and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. (PMID: 10753866)

Protocols

Product Specific Protocols
WB protocol for DNMT1 antibody 82678-2-RRDownload protocol
FC protocol for DNMT1 antibody 82678-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...