DQX1 Polyclonal antibody

• 

  WB analysis of A431 using 33911-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 33911-1-AP (DQX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DQX1 Polyclonal Antibody for WB, ELISA

Cat No. 33911-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, EC:3.6.4.12

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33911-1-AP targets DQX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40792

  Product name: Recombinant human DQX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 62-161 aa of BC075018

  Sequence: DSLQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE

• Full Name: DEAQ box RNA-dependent ATPase 1
• Calculated Molecular Weight: 599 aa, 67 kDa
• Observed Molecular Weight: 79 kDa
• GenBank Accession Number: BC075018
• Gene Symbol: DQX1
• Gene ID (NCBI): 165545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TE96
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DQX1, also known as DEAQ-box RNA helicase 1, is a member of the Asp-Glu-Ala-Asp (DEAD)-box family of RNA helicases, specifically falling into the DEAQ subfamily based on its unique variant motif sequence. These proteins are characterized by conserved motifs involved in ATP binding, hydrolysis, and RNA unwinding/remodeling, playing crucial roles in virtually all aspects of RNA metabolism.