Tested Applications
| Positive WB detected in | HCT 116 cells, HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31777-1-AP targets DRAM in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33711 Product name: Recombinant human DRAM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-90 aa of BC018435 Sequence: AVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAATMYTRYKIVQKQNQTCYFSTP Predict reactive species |
| Full Name | damage-regulated autophagy modulator |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC018435 |
| Gene Symbol | DRAM |
| Gene ID (NCBI) | 55332 |
| RRID | AB_3670110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Damage-regulated autophagy modulator (DRAM) is a lysosomal membrane protein of autophagy that enriches in lung tissue and plays a central role in p53/TP53-mediated apoptosis (PMID: 16839881), which increased autophagy flux by promoting lysosomal acidification and protease activation (PMID: 23696801). It has 238 amino acids and six hydrophobic transmembrane regions. Reports show DRAM to be downregulated in squamous cancers, indicating a selective pressure to lose DRAM during tumor development (PMID: 17102582). Overexpression of DRAM1 can promote mitophagy and enhance mitochondrial function (PMID: 31204316).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DRAM antibody 31777-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

