Tested Applications
| Positive WB detected in | HEK-293 cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60239-1-Ig targets Desmocollin 2 in WB, IF, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5450 Product name: Recombinant human DSC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species |
| Full Name | desmocollin 2 |
| Calculated Molecular Weight | 100 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC063291 |
| Gene Symbol | Desmocollin 2 |
| Gene ID (NCBI) | 1824 |
| RRID | AB_2881362 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02487 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelia and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Desmocollin 2 antibody 60239-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Desmocollin 2 Monoclonal antibody (1H8G1), catalog number 60239-1-Ig, has 7 citations published in Nature Microbiology, Stem Cell Research & Therapy, Journal of Cell Biology, Acta Physiologica, PLoS Pathogens, Molecular Therapy Oncolytics, and Heliyon. The research spans virology (EBV entry), epidermal stem cell biology, desmosomal adhesion, periodontal pathogenesis, nasopharyngeal carcinoma metastasis, and tumor microenvironment/immunotherapy.
| Species | Application | Title |
|---|---|---|
Nat Microbiol Epstein-Barr virus exploits desmocollin 2 as the principal epithelial cell entry receptor. | ||
Stem Cell Res Ther Both Wnt signaling and epidermal stem cell-derived extracellular vesicles are involved in epidermal cell growth. | ||
J Cell Biol DPM1 modulates desmosomal adhesion and epidermal differentiation through SERPINB5 | ||
Acta Physiol (Oxf) Clustering of desmosomal cadherins by desmoplakin is essential for cell-cell adhesion. | ||
PLoS Pathog Porphyromonas gingivalis induces penetration of lipopolysaccharide and peptidoglycan through the gingival epithelium via degradation of junctional adhesion molecule 1. | ||
Mol Ther Oncolytics Exosomal miR-205-5p enhances angiogenesis and nasopharyngeal carcinoma metastasis by targeting desmocollin-2. |
Reviews
What customers say
Two reviewers tested this antibody for Western Blot in cardiomyocyte samples. One user (rated 4/5) reported a clear band around 130 kDa in hiPSC-derived cardiomyocytes at a 1:1000 dilution. Another user (rated 5/5) observed a weak, smeared band at the expected molecular weight in cardiomyocytes at 1:200 dilution but noted the signal quality was insufficient for quantitative analysis. Both used the same lot (10002151). Overall, the antibody detects the target at the correct size but may require optimization for stronger, cleaner signals.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jane (Verified Customer) (02-03-2022) | A very weak and smear band found around the right molecular weight. However, the quality is not good enough to do any analysis or generate results.
|
Jing (Verified Customer) (02-04-2020) | Tested in hiPSC-derived cardiomyocytes, it showed band around 130Kd.
|
