DUSP10 Polyclonal antibody

• 

  IHC staining of human liver cancer using 11689-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11689-1-AP (DUSP10 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 11689-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11689-1-AP (DUSP10 Antibody) at dilution of 1:50 (under 40x lens).

DUSP10 Polyclonal Antibody for IHC, ELISA

Cat No. 11689-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DUSP10, MAP kinase phosphatase 5, MKP 5, MKP5

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

11689-1-AP targets DUSP10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2302

  Product name: Recombinant human DUSP10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC020608

  Sequence: LCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV

• Full Name: dual specificity phosphatase 10
• Calculated Molecular Weight: 482 aa, 53 kDa
• GenBank Accession Number: BC020608
• Gene Symbol: DUSP10
• Gene ID (NCBI): 11221
• RRID: AB_10597553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6W6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Prolif; Bone marrow macrophage-derived exosomal miR-143-5p contributes to insulin resistance in hepatocytes by repressing MKP5.; Authors - Linfang Li
human	WB	Mol Carcinog; PMID: 29856104; Authors - Xinzhe Li
human	WB	Cell Death Dis; Direct conversion of human umbilical cord mesenchymal stem cells into retinal pigment epithelial cells for treatment of retinal degeneration; Authors - Xiaoman Zhu