DYNC1I2 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 12219-1-AP (same clone as 12219-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12219-1-AP (same clone as 12219-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 12219-1-AP (same clone as 12219-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 12219-1-AP (same clone as 12219-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12219-1-AP (DYNC1I2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 12219-1-AP (same clone as 12219-1-PBS)

  IP result of anti-DYNC1I2 (IP:12219-1-AP, 4ug; Detection:12219-1-AP 1:500) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12219-1-AP (same clone as 12219-1-PBS)

  IP result of anti-DYNC1I2 (IP:12219-1-AP, 4ug; Detection:12219-1-AP 1:500) with HeLa cells lysate 2080 ug. This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 12219-1-AP (same clone as 12219-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 12219-1-AP (same clone as 12219-1-PBS)

  Immunofluorescent analysis of A375 cells using 12219-1-AP (DYNC1I2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12219-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DYNC1I2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12219-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

IC2, DNCIC2, DNCI2, DH IC-2, DH IC 2

---

Product Information

12219-1-PBS targets DYNC1I2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2873

  Product name: Recombinant human DYNC1I2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 304-612 aa of BC015038

  Sequence: HCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

• Full Name: dynein, cytoplasmic 1, intermediate chain 2
• Calculated Molecular Weight: 612 aa, 68 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC015038
• Gene Symbol: DYNC1I2
• Gene ID (NCBI): 1781
• RRID: AB_2093630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13409
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.