DYNLRB2 Polyclonal antibody, PBS Only

• 

  WB analysis using 16537-1-AP (same clone as 16537-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16537-1-AP (DYNLRB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16537-1-PBS in a different storage buffer formulation.

DYNLRB2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16537-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16537-1-PBS targets DYNLRB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9842

  Product name: Recombinant human DYNLRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC054892

  Sequence: MAEVEETLKRIQSHKGVIGTMVVNAEDPRFVTFKYARQLTAFQRKSGQQITIKD

• Full Name: dynein, light chain, roadblock-type 2
• Calculated Molecular Weight: 54 aa, 6 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC054892
• Gene Symbol: DYNLRB2
• Gene ID (NCBI): 83657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TF09
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DYNLRB2(Dynein light chain roadblock-type-2) also known as DNCL2B, DNLC2B, belongs to the GAMAD family. DYNLRB2 is a male meiosis-upregulated dynein light chain that is indispensable for spindle formation in meiosis I (PMID: 36973253). DYNLRB2 expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients (PMID: 11750132).