DYRK4 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 12890-2-AP (same clone as 12890-2-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12890-2-AP (DYRK4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12890-2-AP (same clone as 12890-2-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12890-2-AP (DYRK4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 12890-2-AP (same clone as 12890-2-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 12890-2-AP (DYRK4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 12890-2-AP (same clone as 12890-2-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12890-2-AP (DYRK4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12890-2-AP (same clone as 12890-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12890-2-AP (DYRK4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12890-2-AP (same clone as 12890-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 12890-2-AP (DYRK4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12890-2-PBS in a different storage buffer formulation.

DYRK4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12890-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12890-2-PBS targets DYRK4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3515

  Product name: Recombinant human DYRK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-400 aa of BC031244

  Sequence: YEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI

• Full Name: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
• Calculated Molecular Weight: 520 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC031244
• Gene Symbol: DYRK4
• Gene ID (NCBI): 8798
• RRID: AB_2094086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dual-specificity tyrosine phosphorylation regulated kinase 4(DYRK4), belongs to a conserved family of serine/threonine protein kinases. DYRK4 is thought to function in the regulation of cell differentiation and proliferation, survival, and in development. DYRK4 has 5 isoforms with molecular weight of 59, 72 and 73 kDa.