E2F6 Polyclonal antibody, PBS Only

• 

  WB analysis using 31464-1-AP (same clone as 31464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31464-1-AP (E2F6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31464-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 31464-1-AP (same clone as 31464-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using E2F6 antibody (31464-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31464-1-PBS in a different storage buffer formulation.

E2F6 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31464-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

31464-1-PBS targets E2F6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35112

  Product name: Recombinant human E2F6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-281 aa of BC008348

  Sequence: DVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN

• Full Name: E2F transcription factor 6
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC008348
• Gene Symbol: E2F6
• Gene ID (NCBI): 1876
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75461
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

E2F6 is a member of the E2F family of TFs that control cell proliferation and cell fate. Cancer patients with high E2F6 expression in tumors, such as glioblastoma, breast cancer, and hepatocellular carcinoma, have poor prognosis.