Tested Applications
| Positive WB detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24489-1-AP targets E2F7 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21599 Product name: Recombinant human E2F7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 369-713 aa of BC136366 Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA Predict reactive species |
| Full Name | E2F transcription factor 7 |
| Calculated Molecular Weight | 911 aa, 100 kDa |
| Observed Molecular Weight | ~100 kDa |
| GenBank Accession Number | BC136366 |
| Gene Symbol | E2F7 |
| Gene ID (NCBI) | 144455 |
| RRID | AB_2879569 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96AV8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
E2F7, also named E2F transcription factor 7, is a 911 amino acid protein belonging to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells, and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 )
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for E2F7 antibody 24489-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The E2F7 antibody (Cat# 24489-1-AP) has 23 citations. These appear in journals including ACS Nano, Cell Death & Disease, Developmental Cell, FASEB Journal, Journal of Biological Chemistry, Acta Biomaterialia, Oncotarget, and International Journal of Cancer. Research fields span oncology (melanoma, thyroid, glioma, breast, gastric, colorectal, renal, lung, and cervical cancers), inflammation, cell proliferation, ferroptosis, and vascular biology. Applications include WB, IF, IHC, CoIP, ChIP, and IP.
| Species | Application | Title |
|---|---|---|
ACS Nano A Noninvasive Nanoeyedrop Therapy for the Inhibition of Uveal Melanoma: Tetrahedral Framework Nucleic Acid-Based Bioswitchable MicroRNA Delivery System | ||
J Adv Res Transducin-like enhancer of split 3 protects against lipopolysaccharide-induced inflammation through DDX5-ATF1-PPP2R5A signaling | ||
Cell Death Dis Functional interplay between E2F7 and ribosomal rRNA gene transcription regulates protein synthesis. | ||
Small Non-Invasive Transdermal Delivery of miR-30a-5p via MUC1-Aptamer-Guided Tetrahedral DNA Nanostructures for Gene Silencing in Cutaneous Melanoma. | ||
Acta Biomater A miRNA-based gene therapy nanodrug synergistically enhances pro-inflammatory antitumor immunity against melanoma | ||
Cell Death Discov Long noncoding RNA LINC00284 facilitates cell proliferation in papillary thyroid cancer via impairing miR-3127-5p targeted E2F7 suppression. |
Reviews
What customers say
User feedback is mixed. One reviewer reported strong ChIP performance in U2OS cells, noting efficiency comparable to or better than a widely used commercial alternative. However, two Western blot users were dissatisfied: one observed no signal in U87MG cells, while another consistently saw non-specific bands at 40 kD and 160 kD but failed to detect the expected band despite multiple dilution and optimization attempts. Overall, the antibody appears reliable for ChIP but may require careful optimization for Western blot applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Umut (Verified Customer) (10-26-2023) | I could not get any signal in the U87 cells.
|
Ekaitz (Verified Customer) (05-03-2023) | We have tested this antibody for Chromatin Immunoprecipitation (ChIP) and it showed similar or even higher efficiency than the Santa Cruz antibody (sc-66870) that we have been using until now in the lab.
|
Shatovisha (Verified Customer) (12-06-2018) | This antibody always produced two non-specific bands at 40kD and one at 160kD, but could never get the correct sized band with several optimizations and antibody dilutions.
|
