EEA1 Monoclonal antibody

• 

  WB analysis of HepG2 using 68065-1-Ig

  WB result of EEA1 antibody (68065-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEA1 transfected HepG2 cells.

• 

  WB analysis using 68065-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68065-1-Ig (EEA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 68065-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68065-1-Ig (EEA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68065-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68065-1-Ig (EEA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 68065-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EEA1 antibody (68065-1-Ig, Clone: 1E11E4 ) at dilution of 1:3000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 68065-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EEA1 antibody (68065-1-Ig, Clone: 1E11E4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

EEA1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68065-1-Ig

Clone No.1E11E4

Publications(18)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1E11E4, Early endosome antigen 1, Endosome-associated protein p162, MST105, MSTP105

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1500-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 12 publications below

Product Information

68065-1-Ig targets EEA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey, zebrafish
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2918806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		EMBO Rep; The USP12/46 deubiquitinases protect integrins from ESCRT-mediated lysosomal degradation; Authors - Kaikai Yu
	WB	J Biol Chem; The ROGDI protein mutated in Kohlschutter-Tonz syndrome is a novel subunit of the Rabconnectin-3 complex implicated in V-ATPase assembly; Authors - Samuel R Winkley
human	IF	Life Sci Alliance; ACE2-EGFR-MAPK signaling contributes to SARS-CoV-2 infection; Authors - Melanie Engler
human	IF	J Alzheimers Dis; High Fat Diet Mediates Amyloid-β Cleaving Enzyme 1 Phosphorylation and SUMOylation, Enhancing Cognitive Impairment in APP/PS1 Mice; Authors - Jian Bao
human	IF	J Virol; Syntaxin-6 restricts SARS-CoV-2 infection by facilitating virus trafficking to autophagosomes; Authors - Hao Sun
pig	IF	J Virol; IFITM proteins are key entry factors for porcine epidemic diarrhea coronavirus; Authors - Lilei Lv

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Aditya (Verified Customer) (11-01-2024)

great with ecl

• Applications: Western Blot