EGLN3 Polyclonal antibody, PBS Only

• 

  WB analysis using 27875-1-AP (same clone as 27875-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27875-1-AP (EGLN3/PHD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27875-1-AP (same clone as 27875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27875-1-AP (EGLN3/PHD3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 27875-1-AP (same clone as 27875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27875-1-AP (EGLN3/PHD3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27875-1-PBS in a different storage buffer formulation.

EGLN3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27875-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

EGLN3/PHD3, PHD3, EC:1.14.11.-, EC:1.14.11.29, Egl nine homolog 3

---

Product Information

27875-1-PBS targets EGLN3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27464

  Product name: Recombinant human EGLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC010992

  Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK

• Full Name: egl nine homolog 3 (C. elegans)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC010992
• Gene Symbol: EGLN3
• Gene ID (NCBI): 112399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6Z9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.