Tested Applications
| Positive IP detected in | HEK-293 cells, BT-549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27223-1-AP targets ELMO2 in IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25832 Product name: Recombinant human ELMO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC000143 Sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA Predict reactive species |
| Full Name | engulfment and cell motility 2 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC000143 |
| Gene Symbol | ELMO2 |
| Gene ID (NCBI) | 63916 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96JJ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ELMO2 (Engulfment and cell motility protein 2), a member of the Elmo protein family, has been implicated in the regulation of Rac1 and Akt activation. ELMO2 is recruited to the plasma membrane and involved in the signaling cascade that controls cytoskeleton dynamics and cell migration (PMID: 27226625). ELMO2 is a cytoskeletal adaptor protein necessary for cell migration and apoptotic cell removal. Loss-of-function mutations in ELMO2, via impaired RAC1 signaling and defective vascular smooth muscles, as the causative factor for autosomal-recessive VMOS (PMID: 27476657).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ELMO2 antibody 27223-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



