ELP2 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse liver using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 13793-1-AP (same clone as 13793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 13793-1-AP (ELP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13793-1-PBS in a different storage buffer formulation.

ELP2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 13793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

13793-1-PBS targets ELP2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4581

  Product name: Recombinant human ELP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 406-756 aa of BC032553

  Sequence: AITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFLLAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCAL

• Full Name: elongation protein 2 homolog (S. cerevisiae)
• Calculated Molecular Weight: 826 aa, 93 kDa
• GenBank Accession Number: BC032553
• Gene Symbol: ELP2
• Gene ID (NCBI): 55250
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IA86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELP2 is a component of the elongator complex which is required for multiple tRNA modifications. The elongator complex catalyzes the formation of carboxymethyluridine in the wobble base at position 34 in tRNAs.