EME1 Polyclonal antibody, PBS Only

• 

  WB analysis of A375 using 12975-1-AP (same clone as 12975-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12975-1-AP (EME1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12975-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 12975-1-AP (same clone as 12975-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 12975-1-AP (EME1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12975-1-PBS in a different storage buffer formulation.

EME1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12975-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12975-1-PBS targets EME1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3580

  Product name: Recombinant human EME1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-584 aa of BC016470

  Sequence: AALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALSLVIVDQEKCFSLELLFFDFLPCTSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD

• Full Name: essential meiotic endonuclease 1 homolog 1 (S. pombe)
• Calculated Molecular Weight: 583 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC016470
• Gene Symbol: EME1
• Gene ID (NCBI): 146956
• RRID: AB_2231333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AY2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.