Product Information
60854-3-PBS targets EMP2 as part of a matched antibody pair:
MP51265-2: 60854-1-PBS capture and 60854-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27330 Product name: Recombinant human EMP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 27-142 aa of BC009687 Sequence: AWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYS Predict reactive species |
| Full Name | epithelial membrane protein 2 |
| Calculated Molecular Weight | 19 kDa |
| GenBank Accession Number | BC009687 |
| Gene Symbol | EMP2 |
| Gene ID (NCBI) | 2013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P54851 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

