Tested Applications
Positive WB detected in | A431 cells, U-251 cells, MCF-7 cells, HUVEC cells, NIH/3T3 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
26421-1-AP targets ENAH in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24200 Product name: Recombinant human ENAH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 501-577 aa of BC095481 Sequence: NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL Predict reactive species |
Full Name | enabled homolog (Drosophila) |
Calculated Molecular Weight | 591 aa, 67 kDa |
Observed Molecular Weight | 85-88 kDa, 75-80 kDa |
GenBank Accession Number | BC095481 |
Gene Symbol | ENAH |
Gene ID (NCBI) | 55740 |
RRID | AB_2880509 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N8S7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for ENAH antibody 26421-1-AP | Download protocol |
IHC protocol for ENAH antibody 26421-1-AP | Download protocol |
WB protocol for ENAH antibody 26421-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |