Tested Applications
| Positive WB detected in | HUVEC cells, HeLa cells, human placenta tissue, mouse lung tissue, rat lung tissue |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human breast cancer tissue, human liver cancer tissue, human lung cancer tissue, human placenta tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10862-1-AP targets Endoglin/CD105 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1287 Product name: Recombinant human Endoglin/CD105 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 331-658 aa of BC014271 Sequence: GGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA Predict reactive species |
| Full Name | endoglin |
| Calculated Molecular Weight | 71 kDa |
| Observed Molecular Weight | 75-90 kDa, 170-180 kDa |
| GenBank Accession Number | BC014271 |
| Gene Symbol | CD105 |
| Gene ID (NCBI) | 2022 |
| RRID | AB_2098906 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17813 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 90-95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Endoglin/CD105 antibody 10862-1-AP | Download protocol |
| IHC protocol for Endoglin/CD105 antibody 10862-1-AP | Download protocol |
| IP protocol for Endoglin/CD105 antibody 10862-1-AP | Download protocol |
| WB protocol for Endoglin/CD105 antibody 10862-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD105/Endoglin antibody (Cat# 10862-1-AP) has accumulated 69 citations in high-impact journals including Cell, Nature Communications, Advanced Science, Bioactive Materials, Developmental Cell, FASEB Journal, Molecular Therapy, and Journal of Biological Chemistry. Associated research fields encompass angiogenesis, mesenchymal stem cell biology, oncology (breast, lung, prostate, renal, medulloblastoma), tissue engineering, bone and cardiac regeneration, neurodegeneration, placental biology, fibrosis, and intervertebral disc degeneration. Primary applications include IF, WB, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Cell Early rhombic lip Protogenin+ve stem cells in a human-specific neurovascular niche initiate and maintain group 3 medulloblastoma | ||
Exploration (Beijing) PSMA-Targeting Macrophage Membrane-Coated Nanoparticles for Precision Diagnosis and Combination Therapy of Prostate Cancer. | ||
Bioact Mater Adipose-derived mesenchymal stem cells (MSCs) are a superior cell source for bone tissue engineering | ||
Bioact Mater Spatiotemporally programming the immune-osteogenic cascade with a dual-immunomodulatory scaffold for functional bone regeneration. | ||
Drug Resist Updat CD105 blockade restores osimertinib sensitivity in drug-resistant EGFR-mutant non-small cell lung cancer | ||
J Extracell Vesicles CD133 Shapes Extracellular Vesicle Cargo and Angiogenic Function in Basal-Like Triple-Negative Breast Cancer. |
Reviews
What customers say
The single review for this antibody rates it 5 stars, noting that the Endoglin/CD105 antibody works very well in immunohistochemistry at a 1:1000 dilution. Overall, the feedback is positive, confirming reliable performance for IHC applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | Endoglin/CD105 antibody works very well
|
