ENPP1 Polyclonal antibody

• 

  WB analysis using 28886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28886-1-AP (ENPP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

ENPP1 Polyclonal Antibody for WB, ELISA

Cat No. 28886-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Alkaline phosphodiesterase I, E NPP 1, Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, secreted form, E-NPP 1, M6S1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28886-1-AP targets ENPP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30355

  Product name: Recombinant human ENPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 788-873 aa of BC059375

  Sequence: DTSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSFYQQRKEPVSDILKLKTHLPTFSQED

• Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 1
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 103-130 kDa
• GenBank Accession Number: BC059375
• Gene Symbol: ENPP1
• Gene ID (NCBI): 5167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22413
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ENPP1, also known as PC1 or PC-1, is a type II transmembrane glycoprotein that serves as a critical enzymatic gatekeeper at the interface of cellular metabolism, mineral homeostasis, and immune signaling. It plays a crucial role in bone mineralization and soft tissue calcification, through hydrolyzing high-energy phosphate bonds to produce inorganic pyrophosphate (PPi), a potent inhibitor of ectopic mineral deposition (PMID: 37871131, PMID: 30799235, PMID: 40535334). ENPP1 inhibition protects cGAMP and ATP and reduces adenosine levels in the tumor microenvironment, activates antigen-presenting cells and increases T-cell infiltration promoting anticancer immunity (PMID: 40410143).