ENT2 Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83461-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83461-1-RR against Human SLC29A2/ENT2 were performed. The affinity constant is 1.39 nM.

ENT2 Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83461-1-RR

Clone No.240090H1

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

ELISA

Synonyms

36 kDa nucleolar protein HNP36, DER12, ENT2, HNP36, SLC29A2

---

Product Information

83461-1-RR targets ENT2 in ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23310

  Product name: Recombinant human SLC29A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 214-321 aa of BC093634

  Sequence: PHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSP

• Full Name: solute carrier family 29 (nucleoside transporters), member 2
• GenBank Accession Number: BC093634
• Gene Symbol: SLC29A2
• Gene ID (NCBI): 3177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q14542
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.