Tested Applications
| Positive WB detected in | A431 cells, mouse colon tissue, rat colon tissue |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human colon tissue, mouse colon tissue, mouse stomach tissue, human stomach cancer tissue, human colorectal cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, MCF-7 cells, mouse lung tissue |
| Positive IF-Fro detected in | mouse colon tissue |
| Positive IF/ICC detected in | HT-29 cells, MCF-7 cells |
| Positive FC detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) | FC : 0.50 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21050-1-AP targets EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15393 Product name: Recombinant human EPCAM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-264 aa of BC014785 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL Predict reactive species |
| Full Name | epithelial cell adhesion molecule |
| Calculated Molecular Weight | 314 aa, 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC014785 |
| Gene Symbol | EPCAM |
| Gene ID (NCBI) | 4072 |
| RRID | AB_10693684 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16422 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for EPCAM/CD326 antibody 21050-1-AP | Download protocol |
| IF protocol for EPCAM/CD326 antibody 21050-1-AP | Download protocol |
| IHC protocol for EPCAM/CD326 antibody 21050-1-AP | Download protocol |
| IP protocol for EPCAM/CD326 antibody 21050-1-AP | Download protocol |
| WB protocol for EPCAM/CD326 antibody 21050-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EPCAM/CD326 Polyclonal antibody (Cat# 21050-1-AP) has accumulated 144 citations. Publications span high-impact journals including Nature Communications, Cancer Cell, Molecular Cancer, Cell Metabolism, PNAS, EMBO Journal, Nature Immunology, Gut, Theranostics, and Advanced Science. Key research fields encompass oncology (colorectal, breast, liver, lung, esophageal, and gastric cancers), cancer stem cells, tumor microenvironment, immunotherapy, epithelial-mesenchymal transition, inflammatory bowel disease, pulmonary fibrosis, extracellular vesicles, organoid models, ferroptosis, and single-cell genomics.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Single-cell exome sequencing reveals polyclonal seeding and TRPS1 mutations in colon cancer metastasis | ||
Signal Transduct Target Ther Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy | ||
Cancer Cell Loss of Lkb1 and Pten leads to lung squamous cell carcinoma with elevated PD-L1 expression. | ||
Mol Cancer EIF4A3/circPTGR1/miR-4725-5p positive- feedback loop promotes colorectal cancer progression via FAK/AKT signaling pathway. | ||
Mol Cancer m6A methylation reader IGF2BP2 activates endothelial cells to promote angiogenesis and metastasis of lung adenocarcinoma |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrew (Verified Customer) (07-12-2024) | Got a clean band at the desired molecular weight for EPCAM on the first attempt of using this primary antibody for Western Blot. Also, there was very little background. Overall, very happy with this product.
|
