• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated EPCAM/CD326 Polyclonal antibody

EPCAM/CD326 Polyclonal Antibody for IF/ICC, FC
Cat No. CL555-21050

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC

EPCAM, EGP, CO17 1A, CO 17A, Cell surface glycoprotein Trop-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHT-29 cells
Positive FC detected inHT-29 cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-21050 targets EPCAM/CD326 in IF/ICC, FC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15393

Product name: Recombinant human EPCAM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-264 aa of BC014785

Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL

Predict reactive species
Full Name epithelial cell adhesion molecule
Calculated Molecular Weight 314 aa, 35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC014785
Gene Symbol EPCAM
Gene ID (NCBI) 4072
RRIDAB_2923892
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16422
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)

Protocols

Product Specific Protocols
FC protocol for CL555 EPCAM/CD326 antibody CL555-21050Download protocol
IF protocol for CL555 EPCAM/CD326 antibody CL555-21050Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...