EPHX4 Polyclonal antibody

• 

  WB analysis using 25565-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25565-1-AP (EPHX4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

EPHX4 Polyclonal Antibody for WB, ELISA

Cat No. 25565-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ABHD7, EPHX4, EPHXRP, epoxide hydrolase 4

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

25565-1-AP targets EPHX4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22238

  Product name: Recombinant human EPHX4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 175-264 aa of BC041475

  Sequence: AWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAY

• Full Name: epoxide hydrolase 4
• Calculated Molecular Weight: 362 aa, 42 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC041475
• Gene Symbol: EPHX4
• Gene ID (NCBI): 253152
• RRID: AB_3085805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUS5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPHX4 (Epoxide Hydrolase 4) is a protein coding gene and localized almost exclusively on the surface of lipid droplets(PMID:25523620).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gene; Exploring the functional and prognostic roles of EPHX4 in pancreatic cancer: Insights from bioinformatics and experimental validation; Authors - Shaoyang Huang ; KD Validated