EPOR Polyclonal antibody, PBS Only

• 

  WB analysis using 30766-1-AP (same clone as 30766-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30766-1-AP (EPOR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30766-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 30766-1-AP (same clone as 30766-1-PBS)

  WB result of EPOR antibody (30766-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPOR transfected Jurkat cells. This data was developed using the same antibody clone with 30766-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EPOR Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30766-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EPO R, EPO-R, erythropoietin receptor

---

Product Information

30766-1-PBS targets EPOR in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33956

  Product name: Recombinant human EPOR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-250 aa of NM_000121.4

  Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

• Full Name: erythropoietin receptor
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_000121.4
• Gene Symbol: EPOR
• Gene ID (NCBI): 2057
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19235
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257).