• Featured Product
  • KD/KO Validated

EPOR Polyclonal antibody, PBS Only

EPOR Polyclonal Antibody for WB, Indirect ELISA
Cat No. 30766-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

EPO R, EPO-R, erythropoietin receptor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30766-1-PBS targets EPOR in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag33956

Product name: Recombinant human EPOR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-250 aa of NM_000121.4

Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Predict reactive species
Full Name erythropoietin receptor
Calculated Molecular Weight55 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_000121.4
Gene Symbol EPOR
Gene ID (NCBI) 2057
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19235
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257).

Loading...
||
New chat Able
正在加载,请稍候...