EPPK1 Polyclonal antibody

• 

  WB analysis using 31475-1-AP

  L02 cells were subjected to Tris-Acetate gel system followed by western blot with 31475-1-AP (EPPK1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 31475-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 31475-1-AP (EPPK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 31475-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 31475-1-AP (EPPK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EPPK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31475-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EPPK, EPIPL, EPIPL1, Epiplakin

---

Tested Applications

• Positive WB detected in: L02 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31475-1-AP targets EPPK1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35749

  Product name: Recombinant human EPPK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1400-1570 aa of NM_031308.3

  Sequence: NKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVLEVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEMDSVKRSLEGG

• Full Name: epiplakin 1
• Calculated Molecular Weight: 555 kDa
• Observed Molecular Weight: 500-600 kDa
• GenBank Accession Number: NM_031308.3
• Gene Symbol: EPPK1
• Gene ID (NCBI): 83481
• RRID: AB_3669999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P58107
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epplakin 1 (EPPK1), belonging to the plakin family, is involved in connecting intermediate filaments and regulating their reorganization in stress response. Studies have shown that EPPK1 is involved in the progression of various cancers, such as liver cancer, cervical cancer, and bladder urothelial carcinoma.