EPS15 Polyclonal antibody, PBS Only

• 

  WB analysis using 31301-1-AP (same clone as 31301-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31301-1-AP (EPS15 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31301-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 31301-1-AP (same clone as 31301-1-PBS)

  WB result of EPS15 antibody (31301-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPS15 transfected MCF-7 cells. This data was developed using the same antibody clone with 31301-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EPS15 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31301-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AF 1P, AF1P, MLLT5, Protein AF 1p, Protein Eps15

---

Product Information

31301-1-PBS targets EPS15 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35282

  Product name: Recombinant human EPS15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 700-860 aa of NM_001981.3

  Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK

• Full Name: epidermal growth factor receptor pathway substrate 15
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_001981.3
• Gene Symbol: EPS15
• Gene ID (NCBI): 2060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P42566
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153).