Product Information
84564-2-PBS targets ER in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2234 Product name: Recombinant Human ER protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-116 aa of BC128573 Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ Predict reactive species |
Full Name | estrogen receptor 1 |
Calculated Molecular Weight | 595 aa, 66 kDa |
GenBank Accession Number | BC128573 |
Gene Symbol | ER |
Gene ID (NCBI) | 2099 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P03372 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |