Product Information
84564-8-PBS targets ER as part of a matched antibody pair:
MP01406-2: 84564-12-PBS capture and 84564-8-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2234 Product name: Recombinant Human ER protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-116 aa of BC128573 Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ Predict reactive species |
Full Name | estrogen receptor 1 |
Calculated Molecular Weight | 595 aa, 66 kDa |
GenBank Accession Number | BC128573 |
Gene Symbol | ER |
Gene ID (NCBI) | 2099 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P03372 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |