ERCC5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67055-1-Ig (same clone as 67055-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67055-1-Ig (ERCC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67055-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67055-1-Ig (same clone as 67055-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67055-1-Ig (ERCC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67055-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 67055-1-Ig (same clone as 67055-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 67055-1-Ig (ERCC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67055-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 67055-1-Ig (same clone as 67055-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67055-1-Ig (ERCC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67055-1-PBS in a different storage buffer formulation.

ERCC5 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67055-1-PBS

Clone No.1G2C9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

XPG, 1G2C9, COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells

---

Product Information

67055-1-PBS targets ERCC5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28561

  Product name: Recombinant human ERCC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 880-1186 aa of BC031522

  Sequence: EFPGHGLEPLLKFSEWWHEAQKNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

• Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 5
• Calculated Molecular Weight: 1186 aa, 133 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC031522
• Gene Symbol: ERCC5
• Gene ID (NCBI): 2073
• RRID: AB_2882366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P28715
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human genes correcting DNA repair defects are termed excision-repair cross-complementing or ERCC genes. The ERCC5 gene corrects the excision repair deficiency of Chinese hamster ovary cell line UV135 of complementation group 5. The human ERCC5 gene product is a structure-specific endonuclease required for making the 3-prime incision during DNA nucleotide excision-repair (NER). It also plays an important role in regulating DNA excision repair, removal of bulky lesions caused by environmental chemicals or UV light [PMID:22815677]. The calculated molecular weight of ERCC5 is 133 kDa, but the modified ERCC5 protein is about 200 kDa.