ERCC6L Polyclonal antibody, PBS Only

• 

  WB analysis of human heart using 15688-1-AP (same clone as 15688-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15688-1-AP (ERCC6L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15688-1-AP (same clone as 15688-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15688-1-AP (ERCC6L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 15688-1-AP (same clone as 15688-1-PBS)

  WB result of ERCC6L antibody (15688-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERCC6L transfected Jurkat cells. This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 15688-1-AP (same clone as 15688-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15688-1-AP (ERCC6L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15688-1-AP (same clone as 15688-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15688-1-AP (ERCC6L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15688-1-AP (same clone as 15688-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15688-1-AP (ERCC6L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15688-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ERCC6L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15688-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15688-1-PBS targets ERCC6L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8223

  Product name: Recombinant human ERCC6L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-454 aa of BC008808

  Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN

• Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 6-like
• Calculated Molecular Weight: 419 aa, 46 kDa, 141 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC008808
• Gene Symbol: ERCC6L
• Gene ID (NCBI): 54821
• RRID: AB_2098171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2NKX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa.