ERK5 Polyclonal antibody, PBS Only

• 

  WB analysis using 11164-1-AP (same clone as 11164-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11164-1-AP (MAPK7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11164-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 11164-1-AP (same clone as 11164-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11164-1-AP (ERK5 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11164-1-PBS in a different storage buffer formulation.

ERK5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11164-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ERK 5, MAPK7, BMK-1, EC:2.7.11.24, ERK-5

---

Product Information

11164-1-PBS targets ERK5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1648

  Product name: Recombinant human MAPK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC009963

  Sequence: MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKY

• Full Name: mitogen-activated protein kinase 7
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC009963
• Gene Symbol: MAPK7
• Gene ID (NCBI): 5598
• RRID: AB_2877749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.