Tested Applications
| Positive WB detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32079-1-AP targets ESM1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36144 Product name: Recombinant human ESM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-184 aa of BC011989 Sequence: KDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species |
| Full Name | endothelial cell-specific molecule 1 |
| Calculated Molecular Weight | 184 aa, 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC011989 |
| Gene Symbol | ESM1 |
| Gene ID (NCBI) | 11082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NQ30 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ESM1, also known as endothelial cell-specific molecule 1 or endocan, is a protein-coding gene that encodes a secreted protein. It is primarily expressed in endothelial cells of human lung and kidney tissues, and its expression is regulated by cytokines, suggesting a role in endothelium-dependent pathological disorders. ESM1 has been implicated in various diseases, including gastric cancer, hypertension, and cervical cancer. In cervical cancer, ESM1 is overexpressed and acts as an independent prognostic factor associated with poor clinical outcomes. It promotes carcinoma angiogenesis and cervical squamous cell carcinoma progression through the VEGF/ERK signaling pathway.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ESM1 antibody 32079-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

