Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ETS1 Polyclonal antibody

ETS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ChIP, ELISA

Protein C-ets-1, EWSR2, ETS 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ETS1 in ?

Tested Applications

Positive WB detected inJurkat cells, mouse thymus tissue, Raji cells
Positive IHC detected inrat spleen tissue, mouse spleen tissue, rat lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12118-1-AP targets ETS1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2127

Product name: Recombinant human ETS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-272 aa of BC017314

Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

Predict reactive species
Full Name v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Calculated Molecular Weight 441 aa, 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC017314
Gene Symbol ETS1
Gene ID (NCBI) 2113
RRIDAB_10664925
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14921
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo. The ETS1 protein exists as three isoforms: ETS1-p51, ETS1-p42, ETS1-p27 ranging in size from 27 to 51 kDa.

Protocols

Product Specific Protocols
IF protocol for ETS1 antibody 12118-1-APDownload protocol
IHC protocol for ETS1 antibody 12118-1-APDownload protocol
WB protocol for ETS1 antibody 12118-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-ETS1 monoclonal antibody (Cat# 12118-1-AP) has 26 citations in journals including Cell Stem Cell, Nature Communications, Advanced Science, Cell Reports, Communications Biology, and Oncotarget. Research fields span oncology (AML, renal cell carcinoma, neuroblastoma, prostate cancer), epigenetics (m6A RNA modification, histone demethylation), immunology (asthma, EAE), pulmonary disease (bronchopulmonary dysplasia, COPD), cardiovascular protection, and reproductive endocrinology.

SpeciesApplicationTitle
humanWB

Cell Stem Cell

PSPC1 exerts an oncogenic role in AML by regulating a leukemic transcription program in cooperation with PU.1

Authors - Juyeong Hong
humanWB

Nat Commun

HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1

Authors - Qiong Zhang
humanWB

Adv Sci (Weinh)

HDAC8 Enhances the Function of HIF-2α by Deacetylating ETS1 to Decrease the Sensitivity of TKIs in ccRCC

Authors - Kang Qian
  • KD Validated
humanWB

Int J Biol Sci

The RNF26/CBX7 axis modulates the TNF pathway to promote cell proliferation and regulate sensitivity to TKIs in ccRCC.

Authors - Wentao Liu
humanWB

Cell Commun Signal

HMGB3 promotes the malignant phenotypes and stemness of epithelial ovarian cancer through the MAPK/ERK signaling pathway

Authors - Hanlin Ma
humanWB

Cell Death Discov

METTL14 promotes neuroblastoma formation by inhibiting YWHAH via an m6A-YTHDF1-dependent mechanism

Authors - Jianwei Wang
Loading...
||
New chat

Able™

正在加载,请稍候...