Tested Applications
| Positive WB detected in | Jurkat cells, mouse thymus tissue, Raji cells |
| Positive IHC detected in | rat spleen tissue, mouse spleen tissue, rat lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12118-1-AP targets ETS1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2127 Product name: Recombinant human ETS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-272 aa of BC017314 Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT Predict reactive species |
| Full Name | v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
| Calculated Molecular Weight | 441 aa, 50 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC017314 |
| Gene Symbol | ETS1 |
| Gene ID (NCBI) | 2113 |
| RRID | AB_10664925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14921 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo. The ETS1 protein exists as three isoforms: ETS1-p51, ETS1-p42, ETS1-p27 ranging in size from 27 to 51 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ETS1 antibody 12118-1-AP | Download protocol |
| IHC protocol for ETS1 antibody 12118-1-AP | Download protocol |
| WB protocol for ETS1 antibody 12118-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ETS1 monoclonal antibody (Cat# 12118-1-AP) has 26 citations in journals including Cell Stem Cell, Nature Communications, Advanced Science, Cell Reports, Communications Biology, and Oncotarget. Research fields span oncology (AML, renal cell carcinoma, neuroblastoma, prostate cancer), epigenetics (m6A RNA modification, histone demethylation), immunology (asthma, EAE), pulmonary disease (bronchopulmonary dysplasia, COPD), cardiovascular protection, and reproductive endocrinology.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell PSPC1 exerts an oncogenic role in AML by regulating a leukemic transcription program in cooperation with PU.1 | ||
Nat Commun HIV reprograms host m 6 Am RNA methylome by viral Vpr protein-mediated degradation of PCIF1 | ||
Adv Sci (Weinh) HDAC8 Enhances the Function of HIF-2α by Deacetylating ETS1 to Decrease the Sensitivity of TKIs in ccRCC
| ||
Int J Biol Sci The RNF26/CBX7 axis modulates the TNF pathway to promote cell proliferation and regulate sensitivity to TKIs in ccRCC. | ||
Cell Commun Signal HMGB3 promotes the malignant phenotypes and stemness of epithelial ovarian cancer through the MAPK/ERK signaling pathway | ||
Cell Death Discov METTL14 promotes neuroblastoma formation by inhibiting YWHAH via an m6A-YTHDF1-dependent mechanism |





















