EXOSC10 Polyclonal antibody

• 

  WB analysis of HeLa using 11178-1-AP

  WB result of EXOSC10 antibody (11178-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EXOSC10 transfected HeLa cells.

• 

  IP experiment of MCF-7 using 11178-1-AP

  IP result of anti-EXOSC10 (IP:11178-1-AP, 4ug; Detection:11178-1-AP 1:300) with MCF-7 cells lysate 3200 ug.

• 

  IHC staining of human breast cancer using 11178-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11178-1-AP (EXOSC10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of NIH/3T3 using 11178-1-AP

  Immunofluorescent analysis of NIH/3T3 cells using 11178-1-AP (EXOSC10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

EXOSC10 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11178-1-AP

Publications(8)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

Rrp6p, RRP6, PM/Scl-100, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, Exosome complex component 10

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below
• RIP: See 1 publications below

Product Information

11178-1-AP targets EXOSC10 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1666

  Product name: Recombinant human EXOSC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-885 aa of BC039901

  Sequence: VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

• Full Name: exosome component 10
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC039901
• Gene Symbol: EXOSC10
• Gene ID (NCBI): 5394
• RRID: AB_2293792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01780
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear
ucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Nat Commun; TASOR epigenetic repressor cooperates with a CNOT1 RNA degradation pathway to repress HIV.; Authors - Roy Matkovic
human	WB	Cell Rep; Human Telomerase RNA Processing and Quality Control.; Authors - Chi-Kang Tseng ; KD Validated
mouse	WB,RIP	Development; Post-transcription regulation by the exosome complex is required for cell survival and forebrain development by repressing P53 signaling.; Authors - Pauline Antonie Ulmke ; KO Validated
human	IF	RNA; Human Nuclear RNAi-Defective 2 (NRDE2) is an essential RNA splicing factor.; Authors - Alan L Jiao
human	WB	Life Sci Alliance; Low expression of EXOSC2 protects against clinical COVID-19 and impedes SARS-CoV-2 replication; Authors - Tobias Moll
human	WB	Cancer Res; NAT10 drives cisplatin chemoresistance by enhancing ac4C-associated DNA repair in bladder cancer; Authors - Ruihui Xie

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Roy (Verified Customer) (06-12-2024)

Did detect EXOSC10 by WB (1/1000 - overnight incubation at 4°C) in HeLa cells.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HeLa

FH

Tsimafei (Verified Customer) (12-17-2023)

Antibody detect Exosc10 (around 100 kDa on the image). However non-specific bands are observed in higher molecular weight area

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mESCs

EXOSC10 Antibody Western Blot validation (1:2000 dilution) in mESCs (Cat no:11178-1-AP)