Product Information
84824-1-PBS targets EZH2 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16789 Product name: Recombinant human EZH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 158-261 aa of BC010858 Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT Predict reactive species |
| Full Name | enhancer of zeste homolog 2 (Drosophila) |
| Calculated Molecular Weight | 751 aa, 86 kDa |
| GenBank Accession Number | BC010858 |
| Gene Symbol | EZH2 |
| Gene ID (NCBI) | 2146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15910 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
