Exportin 4 Polyclonal antibody

• 

  WB analysis using 25373-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25373-1-AP (Exportin 4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25373-1-AP

  WB result of Exportin 4 antibody (25373-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-Exportin 4 transfected HEK-293 cells.

• 

  IHC staining of mouse liver using 25373-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 25373-1-AP (Exportin 4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 25373-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 25373-1-AP (Exportin 4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Exportin 4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25373-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

XPO4, Exp4, Exportin-4, KIAA1721

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HL-60 cells, HeLa cells, RAW 264.7 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25373-1-AP targets Exportin 4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21845

  Product name: Recombinant human XPO4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 776-1124 aa of BC113571

  Sequence: QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLATRHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEFMANVGGLLCVK

• Full Name: exportin 4
• Calculated Molecular Weight: 1151 aa, 130 kDa
• Observed Molecular Weight: 127 kDa
• GenBank Accession Number: BC113571
• Gene Symbol: Exportin 4/XPO4
• Gene ID (NCBI): 64328
• RRID: AB_3085791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

exportin 4 (XPO4) maps to chromosome 13q and belongs to the importin β family which acts as a bidirectional nuclear transport receptor. Decreased XPO4 expression has been shown to associate with hepatocellular carcinoma. A genome-wide copy number variation (CNV) association study in a small cohort of Malaysian subjects identified a CNV in XPO4 to be correlated with the progression of metabolic (dysfunction) associated fatty liver disease (MAFLD). (PMID: 34388518)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Appl Genet; Peptidylprolyl isomerase D circular RNA sensitizes breast cancer to trastuzumab through remodeling HER2 N4-acetylcytidine modification; Authors - Shengting Wang