Product Information
18269-1-AP targets PAR3 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12833 Product name: Recombinant human PAR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-100 aa of BC093648 Sequence: NDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWTGATITVKIKCPEESASHLHVKNATMGYLTSSLSTKLIPAI Predict reactive species |
Full Name | coagulation factor II (thrombin) receptor-like 2 |
Calculated Molecular Weight | 374 aa, 43 kDa |
GenBank Accession Number | BC093648 |
Gene Symbol | PAR3 |
Gene ID (NCBI) | 2151 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00254 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |