Product Information
18269-1-AP targets PAR3 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12833 Product name: Recombinant human PAR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-100 aa of BC093648 Sequence: NDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWTGATITVKIKCPEESASHLHVKNATMGYLTSSLSTKLIPAI Predict reactive species |
| Full Name | coagulation factor II (thrombin) receptor-like 2 |
| Calculated Molecular Weight | 374 aa, 43 kDa |
| GenBank Accession Number | BC093648 |
| Gene Symbol | PAR3 |
| Gene ID (NCBI) | 2151 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00254 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
