FABP1 Recombinant monoclonal antibody

• 

  WB analysis using 86792-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86792-1-RR (FABP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FABP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86792-1-RR

Clone No.251782A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

liver FABP, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1, Fatty acid-binding protein, liver

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86792-1-RR targets FABP1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7273

  Product name: Recombinant human FABP1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-127 aa of NM_001443.3

  Sequence: SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

• Full Name: fatty acid binding protein 1, liver
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: NM_001443.3
• Gene Symbol: FABP1
• Gene ID (NCBI): 2168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07148
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).