FADS2 Polyclonal antibody

• 

  WB analysis using 28034-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 28034-1-AP (FADS2-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 28034-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 28034-1-AP (FADS2-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 28034-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 28034-1-AP (FADS2-Specific antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 28034-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28034-1-AP (FADS2 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 28034-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28034-1-AP (FADS2 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FADS2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28034-1-AP

Publications(11)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Acyl-CoA 6-desaturase, D6D, Delta-6 desaturase, EC:1.14.19.3

---

Tested Applications

• Positive WB detected in: L02 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IF: See 2 publications below

Product Information

28034-1-AP targets FADS2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27709

  Product name: Recombinant human FADS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC009011

  Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

• Full Name: fatty acid desaturase 2
• Calculated Molecular Weight: 445 aa, 49 kDa
• Observed Molecular Weight: 46-52 kDa
• GenBank Accession Number: BC009011
• Gene Symbol: FADS2
• Gene ID (NCBI): 9415
• RRID: AB_2918142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95864
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms and can be detected as 46-52 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Chem Biol; FADS2-dependent fatty acid desaturation dictates cellular sensitivity to ferroptosis and permissiveness for hepatitis C virus replication.; Authors - Daisuke Yamane ; KD Validated
human	WB	FASEB J; PMID: 31199678; Authors - Ge Liu
mouse,human	WB,IF	Immun Inflamm Dis; Identification of Ferroptosis-Related Gene in Age-Related Macular Degeneration Using Machine Learning; Authors - Meijiang Zhu
	IF	BME Front; Multimodal Metabolic Imaging Reveals Pigment Reduction and Lipid Accumulation in Metastatic Melanoma; Authors - Hyeon Jeong Lee
mouse	WB	FASEB J; Comparing Soy and Milk Protein Regulation of Hepatic Omega-3 Fatty Acid Biosynthesis; Authors - Melissa Gonzalez-Soto
mouse	WB	Pharmacol Res; Breaking the synergism of iron overload and miR-122 to rescue lipid accumulation and peroxidation in MASLD; Authors - Yuxiao Tang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jelan (Verified Customer) (10-31-2025)

We use the antibody FAPS2 across various cell lines that we have lysed to check for bands on our western blot to spot the difference and see if our cell lines accurately over expressed or under expressed certain drug treatments we have treated our cells with.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Melanoma cell lines

FH

Xianfeng (Verified Customer) (02-18-2020)

Works well with overexpressed mouse FADS2 but no signal with endogenouse mouse FADS2.

• Applications: Western Blot,

FADS2 Antibody Western Blot, validation ( dilution) in (Cat no:28034-1-AP)

FH

XIANFENG (Verified Customer) (02-06-2020)

Works well with overexpressed mouse FADS2, but does not work with endogenous mouse FADS2 (mouse liver) .

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000

FADS2 Antibody Western Blot, validation (1:1000 dilution) in (Cat no:28034-1-AP)