Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FADS2 Polyclonal antibody

FADS2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28034-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF, ELISA

Acyl-CoA 6-desaturase, D6D, Delta-6 desaturase, EC:1.14.19.3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28034-1-AP targets FADS2 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27709

Product name: Recombinant human FADS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-124 aa of BC009011

Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

Predict reactive species
Full Name fatty acid desaturase 2
Calculated Molecular Weight 445 aa, 49 kDa
Observed Molecular Weight 46-52 kDa
GenBank Accession NumberBC009011
Gene Symbol FADS2
Gene ID (NCBI) 9415
RRIDAB_2918142
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95864
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms and can be detected as 46-52 kDa.

Protocols

Product Specific Protocols
IHC protocol for FADS2 antibody 28034-1-APDownload protocol
WB protocol for FADS2 antibody 28034-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cell Chem Biol

FADS2-dependent fatty acid desaturation dictates cellular sensitivity to ferroptosis and permissiveness for hepatitis C virus replication.

Authors - Daisuke Yamane
  • KD Validated
WB

FASEB J

PMID: 31199678

Authors - Ge Liu
mouseWB,IF

Immun Inflamm Dis

Identification of Ferroptosis-Related Gene in Age-Related Macular Degeneration Using Machine Learning

Authors - Meijiang Zhu
WB

Int J Mol Sci

Polyamine Pathway Inhibitor DENSPM Suppresses Lipid Metabolism in Pheochromocytoma Cell Line

Authors - Hans K Ghayee
mouseWB

Adv Sci (Weinh)

Metabolic Interplay in Acute Lung Injury: PARK7 Integrates FADS1/2-Dependent PUFA Metabolism and H3K14 Lactylation to Attenuate Endothelial Ferroptosis and Dysfunction

Authors - Jian Xu
IF

BME Front

Multimodal Metabolic Imaging Reveals Pigment Reduction and Lipid Accumulation in Metastatic Melanoma

Authors - Hyeon Jeong Lee

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kristen (Verified Customer) (12-15-2025)

Used to evaluate protein expression of FADS2 in syngeneic mouse melanoma cell lines. Variable expression levels, but correct band size seen in some lines

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Murine melanoma cell lines

Casey (Verified Customer) (11-30-2025)

Needed to use a lower antibody dilution (1:500) to see band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: melanoma cells

Haley (Verified Customer) (11-26-2025)

Great reproducible results using this antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cancer cell line

Jelan (Verified Customer) (10-31-2025)

We use the antibody FAPS2 across various cell lines that we have lysed to check for bands on our western blot to spot the difference and see if our cell lines accurately over expressed or under expressed certain drug treatments we have treated our cells with.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Melanoma cell lines

Xianfeng (Verified Customer) (02-18-2020)

Works well with overexpressed mouse FADS2 but no signal with endogenouse mouse FADS2.

  • Applications: Western Blot,
FADS2 Antibody Western Blot, validation ( dilution) in (Cat no:28034-1-AP)

XIANFENG (Verified Customer) (02-06-2020)

Works well with overexpressed mouse FADS2, but does not work with endogenous mouse FADS2 (mouse liver) .

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
FADS2 Antibody Western Blot, validation (1:1000 dilution) in (Cat no:28034-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...