FAM105B Recombinant monoclonal antibody, PBS Only (Capture/Detector)

FAM105B Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83395-2-PBS
Clone No.240267E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

OTULIN, Deubiquitinating enzyme otulin, EC:3.4.19.12, OTU domain-containing deubiquitinase with linear linkage specificity, Protein FAM105B

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83395-2-PBS targets FAM105B as part of a matched antibody pair:

MP00438-1: 83395-2-PBS capture and 83395-3-PBS detection (validated in Cytometric bead array)

MP00438-2: 83395-4-PBS capture and 83395-2-PBS detection (validated in Cytometric bead array)

MP00438-3: 83395-2-PBS capture and 83395-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22302

Product name: Recombinant human FAM105B protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-214 aa of BC007706

Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

Predict reactive species
Full Name family with sequence similarity 105, member B
Calculated Molecular Weight 352 aa, 40 kDa
GenBank Accession NumberBC007706
Gene Symbol FAM105B
Gene ID (NCBI) 90268
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96BN8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...