FAM117B Polyclonal antibody

• 

  WB analysis using 21768-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21768-1-AP (FAM117B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 21768-1-AP

  IP result of anti-FAM117B (IP:21768-1-AP, 4ug; Detection:21768-1-AP 1:500) with HEK-293 cells lysate 920ug.

• Featured Product
• KD/KO Validated

FAM117B Polyclonal Antibody for WB, IP, ELISA

Cat No. 21768-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ELISA

Synonyms

ALS2CR13, FAM117B, Protein FAM117B

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

21768-1-AP targets FAM117B in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16407

  Product name: Recombinant human FAM117B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-128 aa of BC106906

  Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI

• Full Name: family with sequence similarity 117, member B
• Calculated Molecular Weight: 589 aa, 62 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC106906
• Gene Symbol: FAM117B
• Gene ID (NCBI): 150864
• RRID: AB_10804757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1L5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF,IP	J Clin Invest; FAM117B promotes gastric cancer growth and drug resistance by targeting the KEAP1/NRF2 signaling pathway; Authors - Yunjiang Zhou ; KD Validated
human	WB	Cancer Res; Proteomic analysis of ubiquitin ligase KEAP1 reveals associated proteins that inhibit NRF2 ubiquitination.; Authors - Hast Bridgid E BE